PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID LPERR03G07620.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Leersia
Family YABBY
Protein Properties Length: 195aa    MW: 21848.1 Da    PI: 8.7243
Description YABBY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
LPERR03G07620.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1YABBY614.9e-19146146
            YABBY  1 advfssseqvCyvqCnfCntilavsvPstslfkvvtvrCGhCtsll 46
                     +d++s se++Cyv+C++Cnt+lav vP + l+ +vtv+CGhC +l 
  LPERR03G07620.1  1 MDLVSPSEHLCYVRCTYCNTVLAVGVPCKRLMDTVTVKCGHCNNLS 46
                     578999************************************9984 PP

2YABBY95.41.3e-298014696162
            YABBY  96 vsseklsenedeevprvppvirPPekrqrvPsaynrfikeeiqrikasnPdishreafsaaaknWah 162
                      ++   +s  ++e +pr+p v++PPek+ r Psaynrf++eeiqrika+ Pdi hreafs+aaknWa 
  LPERR03G07620.1  80 QPLPLISPTSNEASPRAPFVVKPPEKKHRLPSAYNRFMREEIQRIKAAKPDIPHREAFSMAAKNWAK 146
                      4445568889999****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF046909.8E-466147IPR006780YABBY protein
SuperFamilySSF470951.96E-891148IPR009071High mobility group box domain
Gene3DG3DSA:1.10.30.101.9E-5101148IPR009071High mobility group box domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0010254Biological Processnectary development
GO:0010582Biological Processfloral meristem determinacy
GO:0048479Biological Processstyle development
Sequence ? help Back to Top
Protein Sequence    Length: 195 aa     Download sequence    Send to blast
MDLVSPSEHL CYVRCTYCNT VLAVGVPCKR LMDTVTVKCG HCNNLSFLSP RPPMVQPLSP  60
TDHPLGPFHQ GPCTDCRRNQ PLPLISPTSN EASPRAPFVV KPPEKKHRLP SAYNRFMREE  120
IQRIKAAKPD IPHREAFSMA AKNWAKCDPR CSSTVSTSNS NPEPRVVSAP VPHQERTTEQ  180
VVESFDIFKQ MERSG
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00220DAPTransfer from AT1G69180Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB1065530.0AB106553.1 Oryza sativa Japonica Group DROOPING LEAF mRNA for DL protein, complete cds.
GenBankAY4947130.0AY494713.1 Oryza sativa (japonica cultivar-group) drooping leaf (DL) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015690408.11e-131PREDICTED: protein DROOPING LEAF isoform X2
SwissprotQ76EJ01e-131YABDL_ORYSJ; Protein DROOPING LEAF
TrEMBLA0A0D9VR881e-143A0A0D9VR88_9ORYZ; Uncharacterized protein
STRINGOB03G18700.11e-129(Oryza brachyantha)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69180.15e-53YABBY family protein